Transcription Factor IIH, p62 subunit

• Species: Human
• Expression Host: E. coli
• Tag: His-tag
• Purity: 90%
• Molecular Weight: 64.5 kDa.
• Gene Accession Number: NM_005316.

Applications

1 unit equals 1 nanogram of purified protein. 100 units are sufficient for a protein-protein interaction assay. For research use only.

Formulation and Storage

Protein is in 20 mM Tris-Cl (pH 8.0), 20% Glycerol, 100 mM KCl, 1 mM DTT and 0.2 mM EDTA buffer and kept at -800C. Avoid repeated freeze thaw cycles.

Protein Sequence

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTIS HMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPK FKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNH KQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEK EFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKP LDEGYGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSN MDGNSGDADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSL QYATSQDIINSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAIN QMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPF QEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT

Background

TFIIH, a multisubunit complex is involved in several biological fundamental mechanisms of the cell: transcription, nucleotide excision repair and cell cycle regulation. p62 is one of the six subunits that constitutes the core of TFIIH (1, 2, 3). Analysis of the expression of the p62 gene reveals an over-expression in testis tissue (4). This subunit of TFIIH participates in a variety of protein-protein interactions. For example, Rb competes with TBP and p62 for binding to E2F thus repressing E2F-mediated transactivation (5); herpes simplex virus VP16 and human p53 directly interact with the p62 subunit of TFIIH (6). In addition, TFIIH, via p62 phosphorylation is the major target for mitotic inactivation of transcription (7).
The His tagged recombinant p62 protein is isolated from an E. coli strain that carries the coding sequence of human p62 under the control of a T7 promoter.
p62 has been used for protein-protein interactions assays.

References

1. Feaver, W.J., et al., (1991) J. Biol. Chem. 266, 19000-19005
2. Flores, O., et al., (1992) J. Biol. Chem. 267, 2786-2790
3. Fischer, L. et al., (1992) Science 257, 1392-1395
4. Perez, C., et al., (1998) Gene 213, 73-82
5. Pearson, A., et al., (1997) Oncogene 15, 2643-2658
6. Xiao, H., et al., (1994) Mol Cell Biol. 14, 7013-7024
7. Long, J.J., et al., (1998) Mol Cell Biol. 18, 1467-1476

DISCLAIMER

This products is recommended For RESEARCH USE ONLY and is Not qualified for Use in Diagnostic or Therapeutic Procedures.